Comparison of plasma dipeptidyl peptidase IV activity in two caiman species: Caiman latirostris and Caiman yacare (Crocodylia, Alligatoridae)

Dipeptidyl peptidase IV (DPPIV) is a well-characterized protease with broad substrate specificity, functionally-related to the activity of many bioactive peptides. It plays an important role as physiological regulator of a number of peptides that serve as biochemical messengers within the immune sys...

Descripción completa

Guardado en:
Detalles Bibliográficos
Autores principales: Siroski, P.A., Merchant, M.E., Marcó, M.P.V., Poletta, G.L., Ortega, H.H.
Formato: JOUR
Materias:
broad-snouted caiman
crocodilian immune system
DPPIV
peptidases
yacare caiman
adaptive radiation
bioactivity
biochemical composition
comparative study
concentration (composition)
correlation
crocodilian
enzyme activity
immune system
infectious disease
peptide
plasma
reaction kinetics
species diversity
temperature effect
tolerance
Alligatorinae
Caiman
Caiman latirostris
Caiman yacare
Crocodylidae (all crocodiles)
Acceso en línea:http://hdl.handle.net/20.500.12110/paper_15707555_v61_n2_p199_Siroski
Aporte de:
Biblioteca Digital - Facultad de Ciencias Exactas y Naturales (UBA) de Universidad de Buenos Aires
id todo:paper_15707555_v61_n2_p199_Siroski
record_format dspace
spelling todo:paper_15707555_v61_n2_p199_Siroski2023-10-03T16:26:51Z Comparison of plasma dipeptidyl peptidase IV activity in two caiman species: Caiman latirostris and Caiman yacare (Crocodylia, Alligatoridae) Siroski, P.A. Merchant, M.E. Marcó, M.P.V. Poletta, G.L. Ortega, H.H. broad-snouted caiman crocodilian immune system DPPIV peptidases yacare caiman adaptive radiation bioactivity biochemical composition comparative study concentration (composition) correlation crocodilian enzyme activity immune system infectious disease peptide plasma reaction kinetics species diversity temperature effect tolerance Alligatorinae Caiman Caiman latirostris Caiman yacare Crocodylidae (all crocodiles) Dipeptidyl peptidase IV (DPPIV) is a well-characterized protease with broad substrate specificity, functionally-related to the activity of many bioactive peptides. It plays an important role as physiological regulator of a number of peptides that serve as biochemical messengers within the immune system. Plasma DPPIV activity was characterized with respect to temperature, kinetics and concentration dependence in two species of caiman, the broad-snouted caiman (Caiman latirostris) and the black yacare (Caiman yacare). DPPIV activity showed a significant positive correlation from titrations carried out in the presence of different plasma concentrations. DPPIV activity was lower in C. yacare than in C. latirostris at all temperatures tested. C. yacare DPPIV activity showed a significant increase only at higher temperatures whilst C. latirostris plasma demonstrated a strong positive correlation starting at the lowest temperature, probably due to an adaptation for the tolerance of lower temperatures. Exposure of C. latirostris and C. yacare plasma at different time points showed that plasma DPPIV activities were time-dependent, and that the titer-dependent curves were different for the two species. These results revealed that plasma DPPIV activities were different between these two crocodilian species, which could contribute to the differences in susceptibility to infection between them. © 2011 Koninklijke Brill NV, Leiden. JOUR info:eu-repo/semantics/openAccess http://creativecommons.org/licenses/by/2.5/ar http://hdl.handle.net/20.500.12110/paper_15707555_v61_n2_p199_Siroski
institution Universidad de Buenos Aires
institution_str I-28
repository_str R-134
collection Biblioteca Digital - Facultad de Ciencias Exactas y Naturales (UBA)
topic broad-snouted caiman
crocodilian immune system
DPPIV
peptidases
yacare caiman
adaptive radiation
bioactivity
biochemical composition
comparative study
concentration (composition)
correlation
crocodilian
enzyme activity
immune system
infectious disease
peptide
plasma
reaction kinetics
species diversity
temperature effect
tolerance
Alligatorinae
Caiman
Caiman latirostris
Caiman yacare
Crocodylidae (all crocodiles)
spellingShingle broad-snouted caiman
crocodilian immune system
DPPIV
peptidases
yacare caiman
adaptive radiation
bioactivity
biochemical composition
comparative study
concentration (composition)
correlation
crocodilian
enzyme activity
immune system
infectious disease
peptide
plasma
reaction kinetics
species diversity
temperature effect
tolerance
Alligatorinae
Caiman
Caiman latirostris
Caiman yacare
Crocodylidae (all crocodiles)
Siroski, P.A.
Merchant, M.E.
Marcó, M.P.V.
Poletta, G.L.
Ortega, H.H.
Comparison of plasma dipeptidyl peptidase IV activity in two caiman species: Caiman latirostris and Caiman yacare (Crocodylia, Alligatoridae)
topic_facet broad-snouted caiman
crocodilian immune system
DPPIV
peptidases
yacare caiman
adaptive radiation
bioactivity
biochemical composition
comparative study
concentration (composition)
correlation
crocodilian
enzyme activity
immune system
infectious disease
peptide
plasma
reaction kinetics
species diversity
temperature effect
tolerance
Alligatorinae
Caiman
Caiman latirostris
Caiman yacare
Crocodylidae (all crocodiles)
description Dipeptidyl peptidase IV (DPPIV) is a well-characterized protease with broad substrate specificity, functionally-related to the activity of many bioactive peptides. It plays an important role as physiological regulator of a number of peptides that serve as biochemical messengers within the immune system. Plasma DPPIV activity was characterized with respect to temperature, kinetics and concentration dependence in two species of caiman, the broad-snouted caiman (Caiman latirostris) and the black yacare (Caiman yacare). DPPIV activity showed a significant positive correlation from titrations carried out in the presence of different plasma concentrations. DPPIV activity was lower in C. yacare than in C. latirostris at all temperatures tested. C. yacare DPPIV activity showed a significant increase only at higher temperatures whilst C. latirostris plasma demonstrated a strong positive correlation starting at the lowest temperature, probably due to an adaptation for the tolerance of lower temperatures. Exposure of C. latirostris and C. yacare plasma at different time points showed that plasma DPPIV activities were time-dependent, and that the titer-dependent curves were different for the two species. These results revealed that plasma DPPIV activities were different between these two crocodilian species, which could contribute to the differences in susceptibility to infection between them. © 2011 Koninklijke Brill NV, Leiden.
format JOUR
author Siroski, P.A.
Merchant, M.E.
Marcó, M.P.V.
Poletta, G.L.
Ortega, H.H.
author_facet Siroski, P.A.
Merchant, M.E.
Marcó, M.P.V.
Poletta, G.L.
Ortega, H.H.
author_sort Siroski, P.A.
title Comparison of plasma dipeptidyl peptidase IV activity in two caiman species: Caiman latirostris and Caiman yacare (Crocodylia, Alligatoridae)
title_short Comparison of plasma dipeptidyl peptidase IV activity in two caiman species: Caiman latirostris and Caiman yacare (Crocodylia, Alligatoridae)
title_full Comparison of plasma dipeptidyl peptidase IV activity in two caiman species: Caiman latirostris and Caiman yacare (Crocodylia, Alligatoridae)
title_fullStr Comparison of plasma dipeptidyl peptidase IV activity in two caiman species: Caiman latirostris and Caiman yacare (Crocodylia, Alligatoridae)
title_full_unstemmed Comparison of plasma dipeptidyl peptidase IV activity in two caiman species: Caiman latirostris and Caiman yacare (Crocodylia, Alligatoridae)
title_sort comparison of plasma dipeptidyl peptidase iv activity in two caiman species: caiman latirostris and caiman yacare (crocodylia, alligatoridae)
url http://hdl.handle.net/20.500.12110/paper_15707555_v61_n2_p199_Siroski
work_keys_str_mv AT siroskipa comparisonofplasmadipeptidylpeptidaseivactivityintwocaimanspeciescaimanlatirostrisandcaimanyacarecrocodyliaalligatoridae
AT merchantme comparisonofplasmadipeptidylpeptidaseivactivityintwocaimanspeciescaimanlatirostrisandcaimanyacarecrocodyliaalligatoridae
AT marcompv comparisonofplasmadipeptidylpeptidaseivactivityintwocaimanspeciescaimanlatirostrisandcaimanyacarecrocodyliaalligatoridae
AT polettagl comparisonofplasmadipeptidylpeptidaseivactivityintwocaimanspeciescaimanlatirostrisandcaimanyacarecrocodyliaalligatoridae
AT ortegahh comparisonofplasmadipeptidylpeptidaseivactivityintwocaimanspeciescaimanlatirostrisandcaimanyacarecrocodyliaalligatoridae
_version_ 1782024508503228416

Ejemplares similares