Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior
Seventy-three children between 6 and 7 years of age were presented with a problem having ambiguous subgoal ordering. Performance in this task showed reliable fingerprints: (a) a non-monotonic dependence of performance as a function of the distance between the beginning and the end-states of the prob...
Autores principales: | , , , |
---|---|
Formato: | JOUR |
Materias: | |
Acceso en línea: | http://hdl.handle.net/20.500.12110/paper_03640213_v39_n5_p944_Paz |
Aporte de: |
id |
todo:paper_03640213_v39_n5_p944_Paz |
---|---|
record_format |
dspace |
spelling |
todo:paper_03640213_v39_n5_p944_Paz2023-10-03T15:27:34Z Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior Paz, L. Goldin, A.P. Diuk, C. Sigman, M. Children problem solving First graders Heuristics Monte Carlo Tree Search N-Puzzles Planning Stochastic behavior modeling child child behavior female heuristics human male Monte Carlo method physiology probability problem solving psychology recreation video game Child Child Behavior Female Heuristics Humans Male Markov Chains Monte Carlo Method Play and Playthings Problem Solving Video Games Seventy-three children between 6 and 7 years of age were presented with a problem having ambiguous subgoal ordering. Performance in this task showed reliable fingerprints: (a) a non-monotonic dependence of performance as a function of the distance between the beginning and the end-states of the problem, (b) very high levels of performance when the first move was correct, and (c) states in which accuracy of the first move was significantly below chance. These features are consistent with a non-Markov planning agent, with an inherently inertial decision process, and that uses heuristics and partial problem knowledge to plan its actions. We applied a statistical framework to fit and test the quality of a proposed planning model (Monte Carlo Tree Search). Our framework allows us to parse out independent contributions to problem-solving based on the construction of the value function and on general mechanisms of the search process in the tree of solutions. We show that the latter are correlated with children's performance on an independent measure of planning, while the former is highly domain specific. © 2014 Cognitive Science Society, Inc. Fil:Goldin, A.P. Universidad de Buenos Aires. Facultad de Ciencias Exactas y Naturales; Argentina. Fil:Sigman, M. Universidad de Buenos Aires. Facultad de Ciencias Exactas y Naturales; Argentina. JOUR info:eu-repo/semantics/openAccess http://creativecommons.org/licenses/by/2.5/ar http://hdl.handle.net/20.500.12110/paper_03640213_v39_n5_p944_Paz |
institution |
Universidad de Buenos Aires |
institution_str |
I-28 |
repository_str |
R-134 |
collection |
Biblioteca Digital - Facultad de Ciencias Exactas y Naturales (UBA) |
topic |
Children problem solving First graders Heuristics Monte Carlo Tree Search N-Puzzles Planning Stochastic behavior modeling child child behavior female heuristics human male Monte Carlo method physiology probability problem solving psychology recreation video game Child Child Behavior Female Heuristics Humans Male Markov Chains Monte Carlo Method Play and Playthings Problem Solving Video Games |
spellingShingle |
Children problem solving First graders Heuristics Monte Carlo Tree Search N-Puzzles Planning Stochastic behavior modeling child child behavior female heuristics human male Monte Carlo method physiology probability problem solving psychology recreation video game Child Child Behavior Female Heuristics Humans Male Markov Chains Monte Carlo Method Play and Playthings Problem Solving Video Games Paz, L. Goldin, A.P. Diuk, C. Sigman, M. Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior |
topic_facet |
Children problem solving First graders Heuristics Monte Carlo Tree Search N-Puzzles Planning Stochastic behavior modeling child child behavior female heuristics human male Monte Carlo method physiology probability problem solving psychology recreation video game Child Child Behavior Female Heuristics Humans Male Markov Chains Monte Carlo Method Play and Playthings Problem Solving Video Games |
description |
Seventy-three children between 6 and 7 years of age were presented with a problem having ambiguous subgoal ordering. Performance in this task showed reliable fingerprints: (a) a non-monotonic dependence of performance as a function of the distance between the beginning and the end-states of the problem, (b) very high levels of performance when the first move was correct, and (c) states in which accuracy of the first move was significantly below chance. These features are consistent with a non-Markov planning agent, with an inherently inertial decision process, and that uses heuristics and partial problem knowledge to plan its actions. We applied a statistical framework to fit and test the quality of a proposed planning model (Monte Carlo Tree Search). Our framework allows us to parse out independent contributions to problem-solving based on the construction of the value function and on general mechanisms of the search process in the tree of solutions. We show that the latter are correlated with children's performance on an independent measure of planning, while the former is highly domain specific. © 2014 Cognitive Science Society, Inc. |
format |
JOUR |
author |
Paz, L. Goldin, A.P. Diuk, C. Sigman, M. |
author_facet |
Paz, L. Goldin, A.P. Diuk, C. Sigman, M. |
author_sort |
Paz, L. |
title |
Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior |
title_short |
Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior |
title_full |
Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior |
title_fullStr |
Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior |
title_full_unstemmed |
Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior |
title_sort |
parsing heuristic and forward search in first-graders' game-play behavior |
url |
http://hdl.handle.net/20.500.12110/paper_03640213_v39_n5_p944_Paz |
work_keys_str_mv |
AT pazl parsingheuristicandforwardsearchinfirstgradersgameplaybehavior AT goldinap parsingheuristicandforwardsearchinfirstgradersgameplaybehavior AT diukc parsingheuristicandforwardsearchinfirstgradersgameplaybehavior AT sigmanm parsingheuristicandforwardsearchinfirstgradersgameplaybehavior |
_version_ |
1807316076335202304 |