γ-Band deficiency and abnormal thalamocortical activity in P/Q-type channel mutant mice

Thalamocortical in vivo and in vitro function was studied in mice lacking P/Q-type calcium channels (CaV2.1), in which N-type calcium channels (CaV2.2) supported central synaptic transmission. Unexpectedly, in vitro patch recordings from thalamic neurons demonstrated no γ-band subthreshold oscillati...

Descripción completa

Detalles Bibliográficos
Autores principales:	Llinás, R.R., Choi, S., Urbano, F.J., Shin, H.-S.
Formato:	JOUR
Materias:	1-Octanol Calcium channel Electroencephalogram Patch clamp VSDI calcium channel L type calcium channel N type calcium channel P type calcium channel Q type mutant protein animal cell article brain cortex coma controlled study electroencephalogram in vitro study in vivo study nonhuman oscillation priority journal protein deficiency synaptic transmission thalamus nucleus Animalia Mus
Acceso en línea:	http://hdl.handle.net/20.500.12110/paper_00278424_v104_n45_p17819_Llinas
Aporte de:	Biblioteca Digital - Facultad de Ciencias Exactas y Naturales (UBA) de Universidad de Buenos Aires

id	todo:paper_00278424_v104_n45_p17819_Llinas
record_format	dspace
spelling	todo:paper_00278424_v104_n45_p17819_Llinas2023-10-03T14:37:57Z γ-Band deficiency and abnormal thalamocortical activity in P/Q-type channel mutant mice Llinás, R.R. Choi, S. Urbano, F.J. Shin, H.-S. 1-Octanol Calcium channel Electroencephalogram Patch clamp VSDI calcium channel L type calcium channel N type calcium channel P type calcium channel Q type mutant protein animal cell article brain cortex coma controlled study electroencephalogram in vitro study in vivo study nonhuman oscillation priority journal protein deficiency synaptic transmission thalamus nucleus Animalia Mus Thalamocortical in vivo and in vitro function was studied in mice lacking P/Q-type calcium channels (CaV2.1), in which N-type calcium channels (CaV2.2) supported central synaptic transmission. Unexpectedly, in vitro patch recordings from thalamic neurons demonstrated no γ-band subthreshold oscillation, and voltage-sensitive dye imaging demonstrated an absence of cortical γ-band-dependent columnar activation involving cortical inhibitory interneuron activity. In vivo electroencephalogram recordings showed persistent absence status and a dramatic reduction of γ-band activity. Pharmacological block of T-type calcium channels (CaV3), although not noticeably affecting normal control animals, left the knockout mice in a coma-like state. Hence, although N-type calcium channels can rescue P/Q-dependent synaptic transmission, P/Q calcium channels are essential in the generation of γ-band activity and resultant cognitive function. © 2007 by The National Academy of Sciences of the USA. JOUR info:eu-repo/semantics/openAccess http://creativecommons.org/licenses/by/2.5/ar http://hdl.handle.net/20.500.12110/paper_00278424_v104_n45_p17819_Llinas
institution	Universidad de Buenos Aires
institution_str	I-28
repository_str	R-134
collection	Biblioteca Digital - Facultad de Ciencias Exactas y Naturales (UBA)
topic	1-Octanol Calcium channel Electroencephalogram Patch clamp VSDI calcium channel L type calcium channel N type calcium channel P type calcium channel Q type mutant protein animal cell article brain cortex coma controlled study electroencephalogram in vitro study in vivo study nonhuman oscillation priority journal protein deficiency synaptic transmission thalamus nucleus Animalia Mus
spellingShingle	1-Octanol Calcium channel Electroencephalogram Patch clamp VSDI calcium channel L type calcium channel N type calcium channel P type calcium channel Q type mutant protein animal cell article brain cortex coma controlled study electroencephalogram in vitro study in vivo study nonhuman oscillation priority journal protein deficiency synaptic transmission thalamus nucleus Animalia Mus Llinás, R.R. Choi, S. Urbano, F.J. Shin, H.-S. γ-Band deficiency and abnormal thalamocortical activity in P/Q-type channel mutant mice
topic_facet	1-Octanol Calcium channel Electroencephalogram Patch clamp VSDI calcium channel L type calcium channel N type calcium channel P type calcium channel Q type mutant protein animal cell article brain cortex coma controlled study electroencephalogram in vitro study in vivo study nonhuman oscillation priority journal protein deficiency synaptic transmission thalamus nucleus Animalia Mus
description	Thalamocortical in vivo and in vitro function was studied in mice lacking P/Q-type calcium channels (CaV2.1), in which N-type calcium channels (CaV2.2) supported central synaptic transmission. Unexpectedly, in vitro patch recordings from thalamic neurons demonstrated no γ-band subthreshold oscillation, and voltage-sensitive dye imaging demonstrated an absence of cortical γ-band-dependent columnar activation involving cortical inhibitory interneuron activity. In vivo electroencephalogram recordings showed persistent absence status and a dramatic reduction of γ-band activity. Pharmacological block of T-type calcium channels (CaV3), although not noticeably affecting normal control animals, left the knockout mice in a coma-like state. Hence, although N-type calcium channels can rescue P/Q-dependent synaptic transmission, P/Q calcium channels are essential in the generation of γ-band activity and resultant cognitive function. © 2007 by The National Academy of Sciences of the USA.
format	JOUR
author	Llinás, R.R. Choi, S. Urbano, F.J. Shin, H.-S.
author_facet	Llinás, R.R. Choi, S. Urbano, F.J. Shin, H.-S.
author_sort	Llinás, R.R.
title	γ-Band deficiency and abnormal thalamocortical activity in P/Q-type channel mutant mice
title_short	γ-Band deficiency and abnormal thalamocortical activity in P/Q-type channel mutant mice
title_full	γ-Band deficiency and abnormal thalamocortical activity in P/Q-type channel mutant mice
title_fullStr	γ-Band deficiency and abnormal thalamocortical activity in P/Q-type channel mutant mice
title_full_unstemmed	γ-Band deficiency and abnormal thalamocortical activity in P/Q-type channel mutant mice
title_sort	γ-band deficiency and abnormal thalamocortical activity in p/q-type channel mutant mice
url	http://hdl.handle.net/20.500.12110/paper_00278424_v104_n45_p17819_Llinas
work_keys_str_mv	AT llinasrr gbanddeficiencyandabnormalthalamocorticalactivityinpqtypechannelmutantmice AT chois gbanddeficiencyandabnormalthalamocorticalactivityinpqtypechannelmutantmice AT urbanofj gbanddeficiencyandabnormalthalamocorticalactivityinpqtypechannelmutantmice AT shinhs gbanddeficiencyandabnormalthalamocorticalactivityinpqtypechannelmutantmice
_version_	1807320641223786496

γ-Band deficiency and abnormal thalamocortical activity in P/Q-type channel mutant mice

Ejemplares similares