Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior

Seventy-three children between 6 and 7 years of age were presented with a problem having ambiguous subgoal ordering. Performance in this task showed reliable fingerprints: (a) a non-monotonic dependence of performance as a function of the distance between the beginning and the end-states of the prob...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Goldin, Andrea, Sigman, Mariano
Publicado:	2015
Materias:	Children problem solving First graders Heuristics Monte Carlo Tree Search N-Puzzles Planning Stochastic behavior modeling child child behavior female heuristics human male Monte Carlo method physiology probability problem solving psychology recreation video game Child Child Behavior Female Humans Male Markov Chains Monte Carlo Method Play and Playthings Problem Solving Video Games
Acceso en línea:	https://bibliotecadigital.exactas.uba.ar/collection/paper/document/paper_03640213_v39_n5_p944_Paz http://hdl.handle.net/20.500.12110/paper_03640213_v39_n5_p944_Paz
Aporte de:	Biblioteca Digital - Facultad de Ciencias Exactas y Naturales (UBA) de Universidad de Buenos Aires

id	paper:paper_03640213_v39_n5_p944_Paz
record_format	dspace
spelling	paper:paper_03640213_v39_n5_p944_Paz2023-06-08T15:35:32Z Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior Goldin, Andrea Sigman, Mariano Children problem solving First graders Heuristics Monte Carlo Tree Search N-Puzzles Planning Stochastic behavior modeling child child behavior female heuristics human male Monte Carlo method physiology probability problem solving psychology recreation video game Child Child Behavior Female Heuristics Humans Male Markov Chains Monte Carlo Method Play and Playthings Problem Solving Video Games Seventy-three children between 6 and 7 years of age were presented with a problem having ambiguous subgoal ordering. Performance in this task showed reliable fingerprints: (a) a non-monotonic dependence of performance as a function of the distance between the beginning and the end-states of the problem, (b) very high levels of performance when the first move was correct, and (c) states in which accuracy of the first move was significantly below chance. These features are consistent with a non-Markov planning agent, with an inherently inertial decision process, and that uses heuristics and partial problem knowledge to plan its actions. We applied a statistical framework to fit and test the quality of a proposed planning model (Monte Carlo Tree Search). Our framework allows us to parse out independent contributions to problem-solving based on the construction of the value function and on general mechanisms of the search process in the tree of solutions. We show that the latter are correlated with children's performance on an independent measure of planning, while the former is highly domain specific. © 2014 Cognitive Science Society, Inc. Fil:Goldin, A.P. Universidad de Buenos Aires. Facultad de Ciencias Exactas y Naturales; Argentina. Fil:Sigman, M. Universidad de Buenos Aires. Facultad de Ciencias Exactas y Naturales; Argentina. 2015 https://bibliotecadigital.exactas.uba.ar/collection/paper/document/paper_03640213_v39_n5_p944_Paz http://hdl.handle.net/20.500.12110/paper_03640213_v39_n5_p944_Paz
institution	Universidad de Buenos Aires
institution_str	I-28
repository_str	R-134
collection	Biblioteca Digital - Facultad de Ciencias Exactas y Naturales (UBA)
topic	Children problem solving First graders Heuristics Monte Carlo Tree Search N-Puzzles Planning Stochastic behavior modeling child child behavior female heuristics human male Monte Carlo method physiology probability problem solving psychology recreation video game Child Child Behavior Female Heuristics Humans Male Markov Chains Monte Carlo Method Play and Playthings Problem Solving Video Games
spellingShingle	Children problem solving First graders Heuristics Monte Carlo Tree Search N-Puzzles Planning Stochastic behavior modeling child child behavior female heuristics human male Monte Carlo method physiology probability problem solving psychology recreation video game Child Child Behavior Female Heuristics Humans Male Markov Chains Monte Carlo Method Play and Playthings Problem Solving Video Games Goldin, Andrea Sigman, Mariano Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior
topic_facet	Children problem solving First graders Heuristics Monte Carlo Tree Search N-Puzzles Planning Stochastic behavior modeling child child behavior female heuristics human male Monte Carlo method physiology probability problem solving psychology recreation video game Child Child Behavior Female Heuristics Humans Male Markov Chains Monte Carlo Method Play and Playthings Problem Solving Video Games
description	Seventy-three children between 6 and 7 years of age were presented with a problem having ambiguous subgoal ordering. Performance in this task showed reliable fingerprints: (a) a non-monotonic dependence of performance as a function of the distance between the beginning and the end-states of the problem, (b) very high levels of performance when the first move was correct, and (c) states in which accuracy of the first move was significantly below chance. These features are consistent with a non-Markov planning agent, with an inherently inertial decision process, and that uses heuristics and partial problem knowledge to plan its actions. We applied a statistical framework to fit and test the quality of a proposed planning model (Monte Carlo Tree Search). Our framework allows us to parse out independent contributions to problem-solving based on the construction of the value function and on general mechanisms of the search process in the tree of solutions. We show that the latter are correlated with children's performance on an independent measure of planning, while the former is highly domain specific. © 2014 Cognitive Science Society, Inc.
author	Goldin, Andrea Sigman, Mariano
author_facet	Goldin, Andrea Sigman, Mariano
author_sort	Goldin, Andrea
title	Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior
title_short	Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior
title_full	Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior
title_fullStr	Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior
title_full_unstemmed	Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior
title_sort	parsing heuristic and forward search in first-graders' game-play behavior
publishDate	2015
url	https://bibliotecadigital.exactas.uba.ar/collection/paper/document/paper_03640213_v39_n5_p944_Paz http://hdl.handle.net/20.500.12110/paper_03640213_v39_n5_p944_Paz
work_keys_str_mv	AT goldinandrea parsingheuristicandforwardsearchinfirstgradersgameplaybehavior AT sigmanmariano parsingheuristicandforwardsearchinfirstgradersgameplaybehavior
_version_	1768543802785529856

Parsing Heuristic and Forward Search in First-Graders' Game-Play Behavior

Ejemplares similares