Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning
The response to ischemia/reperfusion and the effects of ischemic post-conditioning (IPC) are sex-dependent, but the mechanisms have not been clarified. Male (M) and female (F) rat hearts isolated and perfused using the Langendorff technique were subject to 30 min of global ischemia (GI) and 60 min r...
Guardado en:
| Autores principales: | , , , , , |
|---|---|
| Formato: | Articulo |
| Lenguaje: | Inglés |
| Publicado: |
2018
|
| Materias: | |
| Acceso en línea: | http://sedici.unlp.edu.ar/handle/10915/99292 https://ri.conicet.gov.ar/11336/95146 |
| Aporte de: |
| id |
I19-R120-10915-99292 |
|---|---|
| record_format |
dspace |
| institution |
Universidad Nacional de La Plata |
| institution_str |
I-19 |
| repository_str |
R-120 |
| collection |
SEDICI (UNLP) |
| language |
Inglés |
| topic |
Ciencias Médicas Female Infarct size Ischemia–reperfusion Ischemic post-conditioning Male |
| spellingShingle |
Ciencias Médicas Female Infarct size Ischemia–reperfusion Ischemic post-conditioning Male Ciocci Pardo, Alejandro Scuri, Sergio González Arbeláez, Luisa Fernanda Caldiz, Claudia Irma Fantinelli, Juliana Catalina Mosca, Susana María Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning |
| topic_facet |
Ciencias Médicas Female Infarct size Ischemia–reperfusion Ischemic post-conditioning Male |
| description |
The response to ischemia/reperfusion and the effects of ischemic post-conditioning (IPC) are sex-dependent, but the mechanisms have not been clarified. Male (M) and female (F) rat hearts isolated and perfused using the Langendorff technique were subject to 30 min of global ischemia (GI) and 60 min reperfusion (R). In IPC hearts, three cycles of 30-sec GI/30-sec R were applied at the beginning of R. Infarct size and myocardial function were assessed. Superoxide production, antioxidant systems, and expressions of phosphorylated forms of serine/threonine kinase (Akt), glycogen synthase kinase 3β (GSK-3β), protein kinase C ε (PKCε), endothelial nitric oxide synthase (eNOS), and apoptosis were measured. In the basal state, superoxide production and apoptosis were lower, and antioxidant systems and phospho-kinase expressions were higher in F rather than in M hearts. After ischemia–reperfusion, infarct size was less in F hearts, and post-ischemic recovery of myocardial function was higher in F rather than in M hearts. Superoxide production, phospho-kinase activity, phospho-eNOS, and apoptosis increased in both sexes while antioxidants decreased in both sexes. After IPC, infarct size, superoxide production, and apoptosis decreased and phospho-eNOS increased in F and M hearts but phospho-kinase expressions and post-ischemic recovery of myocardial function improved only in M hearts. These results show that Akt/GSK-3β/PKCε/eNOS-dependent pathways-mediated superoxide production and apoptosis appear as important factors involved in the observed gender differences. |
| format |
Articulo Articulo |
| author |
Ciocci Pardo, Alejandro Scuri, Sergio González Arbeláez, Luisa Fernanda Caldiz, Claudia Irma Fantinelli, Juliana Catalina Mosca, Susana María |
| author_facet |
Ciocci Pardo, Alejandro Scuri, Sergio González Arbeláez, Luisa Fernanda Caldiz, Claudia Irma Fantinelli, Juliana Catalina Mosca, Susana María |
| author_sort |
Ciocci Pardo, Alejandro |
| title |
Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning |
| title_short |
Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning |
| title_full |
Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning |
| title_fullStr |
Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning |
| title_full_unstemmed |
Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning |
| title_sort |
survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning |
| publishDate |
2018 |
| url |
http://sedici.unlp.edu.ar/handle/10915/99292 https://ri.conicet.gov.ar/11336/95146 |
| work_keys_str_mv |
AT cioccipardoalejandro survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning AT scurisergio survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning AT gonzalezarbelaezluisafernanda survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning AT caldizclaudiairma survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning AT fantinellijulianacatalina survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning AT moscasusanamaria survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning |
| bdutipo_str |
Repositorios |
| _version_ |
1764820493189251072 |