Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning

The response to ischemia/reperfusion and the effects of ischemic post-conditioning (IPC) are sex-dependent, but the mechanisms have not been clarified. Male (M) and female (F) rat hearts isolated and perfused using the Langendorff technique were subject to 30 min of global ischemia (GI) and 60 min r...

Descripción completa

Guardado en:
Detalles Bibliográficos
Autores principales: Ciocci Pardo, Alejandro, Scuri, Sergio, González Arbeláez, Luisa Fernanda, Caldiz, Claudia Irma, Fantinelli, Juliana Catalina, Mosca, Susana María
Formato: Articulo
Lenguaje:Inglés
Publicado: 2018
Materias:
Ciencias Médicas
Female
Infarct size
Ischemia–reperfusion
Ischemic post-conditioning
Male
Acceso en línea:http://sedici.unlp.edu.ar/handle/10915/99292
https://ri.conicet.gov.ar/11336/95146
Aporte de:
SEDICI (UNLP) de Universidad Nacional de La Plata
id I19-R120-10915-99292
record_format dspace
institution Universidad Nacional de La Plata
institution_str I-19
repository_str R-120
collection SEDICI (UNLP)
language Inglés
topic Ciencias Médicas
Female
Infarct size
Ischemia–reperfusion
Ischemic post-conditioning
Male
spellingShingle Ciencias Médicas
Female
Infarct size
Ischemia–reperfusion
Ischemic post-conditioning
Male
Ciocci Pardo, Alejandro
Scuri, Sergio
González Arbeláez, Luisa Fernanda
Caldiz, Claudia Irma
Fantinelli, Juliana Catalina
Mosca, Susana María
Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning
topic_facet Ciencias Médicas
Female
Infarct size
Ischemia–reperfusion
Ischemic post-conditioning
Male
description The response to ischemia/reperfusion and the effects of ischemic post-conditioning (IPC) are sex-dependent, but the mechanisms have not been clarified. Male (M) and female (F) rat hearts isolated and perfused using the Langendorff technique were subject to 30 min of global ischemia (GI) and 60 min reperfusion (R). In IPC hearts, three cycles of 30-sec GI/30-sec R were applied at the beginning of R. Infarct size and myocardial function were assessed. Superoxide production, antioxidant systems, and expressions of phosphorylated forms of serine/threonine kinase (Akt), glycogen synthase kinase 3β (GSK-3β), protein kinase C ε (PKCε), endothelial nitric oxide synthase (eNOS), and apoptosis were measured. In the basal state, superoxide production and apoptosis were lower, and antioxidant systems and phospho-kinase expressions were higher in F rather than in M hearts. After ischemia–reperfusion, infarct size was less in F hearts, and post-ischemic recovery of myocardial function was higher in F rather than in M hearts. Superoxide production, phospho-kinase activity, phospho-eNOS, and apoptosis increased in both sexes while antioxidants decreased in both sexes. After IPC, infarct size, superoxide production, and apoptosis decreased and phospho-eNOS increased in F and M hearts but phospho-kinase expressions and post-ischemic recovery of myocardial function improved only in M hearts. These results show that Akt/GSK-3β/PKCε/eNOS-dependent pathways-mediated superoxide production and apoptosis appear as important factors involved in the observed gender differences.
format Articulo
Articulo
author Ciocci Pardo, Alejandro
Scuri, Sergio
González Arbeláez, Luisa Fernanda
Caldiz, Claudia Irma
Fantinelli, Juliana Catalina
Mosca, Susana María
author_facet Ciocci Pardo, Alejandro
Scuri, Sergio
González Arbeláez, Luisa Fernanda
Caldiz, Claudia Irma
Fantinelli, Juliana Catalina
Mosca, Susana María
author_sort Ciocci Pardo, Alejandro
title Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning
title_short Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning
title_full Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning
title_fullStr Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning
title_full_unstemmed Survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning
title_sort survival kinase-dependent pathways contribute to gender difference in the response to myocardial ischemia–reperfusion and ischemic post-conditioning
publishDate 2018
url http://sedici.unlp.edu.ar/handle/10915/99292
https://ri.conicet.gov.ar/11336/95146
work_keys_str_mv AT cioccipardoalejandro survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning
AT scurisergio survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning
AT gonzalezarbelaezluisafernanda survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning
AT caldizclaudiairma survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning
AT fantinellijulianacatalina survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning
AT moscasusanamaria survivalkinasedependentpathwayscontributetogenderdifferenceintheresponsetomyocardialischemiareperfusionandischemicpostconditioning
bdutipo_str Repositorios
_version_ 1764820493189251072

Ejemplares similares