Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection

Mostrar todas las versiones(2)

This work reports the novel application of carbon-coated magnetite nanoparticles (mNPs@C) as catalytic nanomaterial included in a composite electrode material (mNPs@C/CPE) taking advantages of their intrinsic peroxidase-like activity. The nanostructured electrochemical transducer reveals an improved...

Descripción completa

Guardado en:
Detalles Bibliográficos
Autores principales: Arana, Mercedes, Tettamanti, Cecilia Soledad, Bercoff, Paula Gabriela, Rodríguez, Marcela Cecilia
Formato: article
Lenguaje:Inglés
Publicado: 2021
Materias:
Carbon-coated magnetite nanoparticles
Electrochemical glucose biosensor
Glucose oxidase
Modified-carbon paste electrode
Peroxidase-like activity
Acceso en línea:http://hdl.handle.net/11086/20366
https://doi.org/10.1002/elan.201400159
Aporte de:
Repositorio Digital Universitario (UNC) de Universidad Nacional de Córdoba
id I10-R14111086-20366
record_format dspace
institution Universidad Nacional de Córdoba
institution_str I-10
repository_str R-141
collection Repositorio Digital Universitario (UNC)
language Inglés
topic Carbon-coated magnetite nanoparticles
Electrochemical glucose biosensor
Glucose oxidase
Modified-carbon paste electrode
Peroxidase-like activity
spellingShingle Carbon-coated magnetite nanoparticles
Electrochemical glucose biosensor
Glucose oxidase
Modified-carbon paste electrode
Peroxidase-like activity
Arana, Mercedes
Tettamanti, Cecilia Soledad
Bercoff, Paula Gabriela
Rodríguez, Marcela Cecilia
Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection
topic_facet Carbon-coated magnetite nanoparticles
Electrochemical glucose biosensor
Glucose oxidase
Modified-carbon paste electrode
Peroxidase-like activity
description This work reports the novel application of carbon-coated magnetite nanoparticles (mNPs@C) as catalytic nanomaterial included in a composite electrode material (mNPs@C/CPE) taking advantages of their intrinsic peroxidase-like activity. The nanostructured electrochemical transducer reveals an improved enhancement of the charge transfer for redox processes involving hydrogen peroxide. Likewise, mNPs@C/CPE demonstrated to be highly selective even at elevated concentrations of ascorbic acid and uric acid, the usual interferents of blood glucose analysis. Upon these remarkable results, the composite matrix was further modified by the addition of glucose oxidase as biocatalyst in order to obtain a biosensing strategy (GOx/mNPs@C/CPE) with enhanced properties for the electrochemical detection of glucose. GOx/mNPs@C/CPE exhibit a linear range up to 7.5 x 10-3 mol.L-1 glucose, comprising the entirely physiological range and incipient pathological values. The average sensitivity obtained at –0.100 V was (1.62 ± 0.05)x 105 nA.L.mol-1 (R2 = 0.9992), the detection limit was 2.0 x 10-6 M while the quantification limit was 6.1 x 10-6 mol.L-1. The nanostructured biosensor demonstrated to have an excellent performance for glucose detection in human blood serum even for pathological values.
format article
author Arana, Mercedes
Tettamanti, Cecilia Soledad
Bercoff, Paula Gabriela
Rodríguez, Marcela Cecilia
author_facet Arana, Mercedes
Tettamanti, Cecilia Soledad
Bercoff, Paula Gabriela
Rodríguez, Marcela Cecilia
author_sort Arana, Mercedes
title Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection
title_short Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection
title_full Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection
title_fullStr Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection
title_full_unstemmed Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection
title_sort magnetite nps@c with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection
publishDate 2021
url http://hdl.handle.net/11086/20366
https://doi.org/10.1002/elan.201400159
work_keys_str_mv AT aranamercedes magnetitenpscwithhighlyefficientperoxidaselikecatalyticactivityasanimprovedbiosensingstrategyforselectiveglucosedetection
AT tettamanticeciliasoledad magnetitenpscwithhighlyefficientperoxidaselikecatalyticactivityasanimprovedbiosensingstrategyforselectiveglucosedetection
AT bercoffpaulagabriela magnetitenpscwithhighlyefficientperoxidaselikecatalyticactivityasanimprovedbiosensingstrategyforselectiveglucosedetection
AT rodriguezmarcelacecilia magnetitenpscwithhighlyefficientperoxidaselikecatalyticactivityasanimprovedbiosensingstrategyforselectiveglucosedetection
bdutipo_str Repositorios
_version_ 1764820394245619712

Ejemplares similares