Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection
This work reports the novel application of carbon-coated magnetite nanoparticles (mNPs@C) as catalytic nanomaterial included in a composite electrode material (mNPs@C/CPE) taking advantages of their intrinsic peroxidase-like activity. The nanostructured electrochemical transducer reveals an improved...
Guardado en:
| Autores principales: | , , , |
|---|---|
| Formato: | article |
| Lenguaje: | Inglés |
| Publicado: |
2021
|
| Materias: | |
| Acceso en línea: | http://hdl.handle.net/11086/20366 https://doi.org/10.1002/elan.201400159 |
| Aporte de: |
| id |
I10-R141-11086-20366 |
|---|---|
| record_format |
dspace |
| institution |
Universidad Nacional de Córdoba |
| institution_str |
I-10 |
| repository_str |
R-141 |
| collection |
Repositorio Digital Universitario (UNC) |
| language |
Inglés |
| topic |
Carbon-coated magnetite nanoparticles Electrochemical glucose biosensor Glucose oxidase Modified-carbon paste electrode Peroxidase-like activity |
| spellingShingle |
Carbon-coated magnetite nanoparticles Electrochemical glucose biosensor Glucose oxidase Modified-carbon paste electrode Peroxidase-like activity Arana, Mercedes Tettamanti, Cecilia Soledad Bercoff, Paula Gabriela Rodríguez, Marcela Cecilia Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection |
| topic_facet |
Carbon-coated magnetite nanoparticles Electrochemical glucose biosensor Glucose oxidase Modified-carbon paste electrode Peroxidase-like activity |
| description |
This work reports the novel application of carbon-coated magnetite nanoparticles (mNPs@C) as catalytic nanomaterial included in a composite electrode material (mNPs@C/CPE) taking advantages of their intrinsic peroxidase-like activity. The nanostructured electrochemical transducer reveals an improved enhancement of the charge transfer for redox processes involving hydrogen peroxide. Likewise, mNPs@C/CPE demonstrated to be highly selective even at elevated concentrations of ascorbic acid and uric acid, the usual interferents of blood glucose analysis. Upon these remarkable results, the composite matrix was further modified by the addition of glucose oxidase as biocatalyst in order to obtain a biosensing strategy (GOx/mNPs@C/CPE) with enhanced properties for the electrochemical detection of glucose. GOx/mNPs@C/CPE exhibit a linear range up to 7.5 x 10-3 mol.L-1 glucose, comprising the entirely physiological range and incipient pathological values. The average sensitivity obtained at –0.100 V was (1.62 ± 0.05)x 105 nA.L.mol-1 (R2 = 0.9992), the detection limit was 2.0 x 10-6 M while the quantification limit was 6.1 x 10-6 mol.L-1. The nanostructured biosensor demonstrated to have an excellent performance for glucose detection in human blood serum even for pathological values. |
| format |
article |
| author |
Arana, Mercedes Tettamanti, Cecilia Soledad Bercoff, Paula Gabriela Rodríguez, Marcela Cecilia |
| author_facet |
Arana, Mercedes Tettamanti, Cecilia Soledad Bercoff, Paula Gabriela Rodríguez, Marcela Cecilia |
| author_sort |
Arana, Mercedes |
| title |
Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection |
| title_short |
Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection |
| title_full |
Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection |
| title_fullStr |
Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection |
| title_full_unstemmed |
Magnetite NPs@C with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection |
| title_sort |
magnetite nps@c with highly-efficient peroxidase-like catalytic activity as an improved biosensing strategy for selective glucose detection |
| publishDate |
2021 |
| url |
http://hdl.handle.net/11086/20366 https://doi.org/10.1002/elan.201400159 |
| work_keys_str_mv |
AT aranamercedes magnetitenpscwithhighlyefficientperoxidaselikecatalyticactivityasanimprovedbiosensingstrategyforselectiveglucosedetection AT tettamanticeciliasoledad magnetitenpscwithhighlyefficientperoxidaselikecatalyticactivityasanimprovedbiosensingstrategyforselectiveglucosedetection AT bercoffpaulagabriela magnetitenpscwithhighlyefficientperoxidaselikecatalyticactivityasanimprovedbiosensingstrategyforselectiveglucosedetection AT rodriguezmarcelacecilia magnetitenpscwithhighlyefficientperoxidaselikecatalyticactivityasanimprovedbiosensingstrategyforselectiveglucosedetection |
| bdutipo_str |
Repositorios |
| _version_ |
1764820391920926721 |